> ## Documentation Index
> Fetch the complete documentation index at: https://docs.bunkerbio.com/llms.txt
> Use this file to discover all available pages before exploring further.

# Bunker Longevity: Frontier AI Models for Life Sciences

> Bunker Longevity builds foundation models for drug discovery, protein folding, genomics, and imaging. Hosted API, typed Python SDK, runnable examples.

Bunker Longevity builds foundation models for the life sciences. Every model ships behind a single hosted API and a typed Python SDK. Predict a protein structure, call variants, generate a molecule, or reconstruct a cryo-EM map with the same three calls: deploy, predict, status.

## Install

```bash theme={null}
pip install bunker-fold
```

## Predict

```python theme={null}
from bunker_fold import Bunker

client = Bunker()

result = client.models.bunkerfold_3.predict(
    sequence="MVLSPADKTNVKAAWGKVGAHAGEYGAEALERMFLSFPTTKTYFPHFDLSH"
)

print(result.confidence)      # 0.97
print(result.fold_class)      # 'globin'
print(result.structure_url)   # https://cdn.bunkerbio.com/predictions/...pdb
```

## Model catalog

| Model                                  | Domain                 | Parameters | Endpoint        |
| -------------------------------------- | ---------------------- | ---------- | --------------- |
| [BunkerFold-3](/models/bunkerfold-3)   | Protein structure      | 1.2B       | `bunkerfold-3`  |
| [GenoScan-LLM](/models/genoscan-llm)   | Variant calling        | 800M       | `genoscan-llm`  |
| [MolGen-7](/models/molgen-7)           | Generative chemistry   | 3.4B       | `molgen-7`      |
| [CryoNet](/models/cryonet)             | Cryo-EM reconstruction | 540M       | `cryonet`       |
| [ToxPredict-v2](/models/toxpredict-v2) | Toxicity screening     | 280M       | `toxpredict-v2` |
| [EpiMark](/models/epimark)             | Epigenomic annotation  | 420M       | `epimark`       |

## Base URL

```text theme={null}
https://api.bunkerbio.com/v1
```

All requests use HTTPS bearer token auth. See [Authentication](/authentication) to create a key.

## Endpoints

```http theme={null}
POST  /v1/models/{model}/deploy    # start an inference instance
POST  /v1/models/{model}/predict   # run a prediction
GET   /v1/models/{model}/status    # health and queue depth
POST  /v1/models/{model}/stop      # release resources
```

## Contact

Reach the team at [hello@bunkerbio.com](mailto:hello@bunkerbio.com).