Install the bunker-fold Python Package - Bunker Longevity

bunker-fold is the official Python SDK for Bunker Longevity. A single package gives you a typed client for every model in the catalog, including BunkerFold-3, GenoScan-LLM, MolGen-7, CryoNet, ToxPredict-v2, and EpiMark.

Requirements

Python 3.9 or later
A Bunker Longevity API key (Authentication)

Quick install

pip install bunker-fold

Pick a package manager

pip: the default Python installer.
uv: fast, resolver-first workflow for new projects.
Poetry: lockfile-driven dependency management.
Docker: pre-built image with bunker-fold and CUDA runtime.

Verify

import bunker_fold
print(bunker_fold.__version__)

Configure your API key

Export your key as an environment variable so the SDK picks it up automatically:

export BUNKER_API_KEY="sk_live_..."

Or pass it explicitly:

from bunker_fold import Bunker

client = Bunker(api_key="sk_live_...")

Never commit API keys to source control. See Authentication for rotation and scope guidance.

First call

from bunker_fold import Bunker

client = Bunker()

result = client.models.bunkerfold_3.predict(
    sequence="MVLSPADKTNVKAAWGKVGAHAGEYGAEALERMFLSFPTTKTYFPHFDLSH"
)
print(result.confidence, result.structure_url)