Quickstart: Run Your First Bunker Model

Get your first prediction from a Bunker Longevity model in under five minutes. This guide uses BunkerFold-3 for protein structure prediction, but the same flow works for every model in the catalog.

Install the SDK

Install the bunker-fold Python package, which ships a typed client for every Bunker Longevity model.

pip install bunker-fold

See Installation for uv and poetry alternatives.

Get an API key

Sign in at bunkerbio.com and generate a key from your Bunker Longevity account settings. Treat it like a password.See Authentication for full details on scopes and rotation.

Deploy the model

Deploy a model instance so it is ready to accept inference requests.

curl -X POST https://api.bunkerbio.com/v1/models/bunkerfold-3/deploy \
  -H "Authorization: Bearer $BUNKER_API_KEY"

import requests, os

r = requests.post(
    "https://api.bunkerbio.com/v1/models/bunkerfold-3/deploy",
    headers={"Authorization": f"Bearer {os.environ['BUNKER_API_KEY']}"},
)
print(r.json())

Run inference

Send an amino acid sequence and get a predicted 3D structure back.

curl -X POST https://api.bunkerbio.com/v1/models/bunkerfold-3/predict \
  -H "Authorization: Bearer $BUNKER_API_KEY" \
  -H "Content-Type: application/json" \
  -d '{"sequence": "MVLSPADKTNVKAAWGKVGAHAGEYGAEALERMFLSFPTTKTYFPHFDLSH"}'

r = requests.post(
    "https://api.bunkerbio.com/v1/models/bunkerfold-3/predict",
    headers={"Authorization": f"Bearer {os.environ['BUNKER_API_KEY']}"},
    json={"sequence": "MVLSPADKTNVKAAWGKVGAHAGEYGAEALERMFLSFPTTKTYFPHFDLSH"},
)
print(r.json())

Inspect the response

You get back a confidence score, per-residue coordinates, and timing.

Response

{
  "confidence": 0.97,
  "rmsd": 0.42,
  "residues_resolved": "51/51",
  "fold_class": "globin",
  "time_seconds": 1.8,
  "structure_url": "https://cdn.bunkerbio.com/predictions/abc123.pdb"
}

Next steps

Browse all models: compare all six models and pick the one for your task.
API Reference: full request and response schemas for every endpoint.

Get Started

Models

API Reference

Installation

Quickstart: Run Your First Bunker Model

Next steps

​Next steps

Next steps